PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_06764
Common NameKK1_006955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 534aa    MW: 59050.5 Da    PI: 8.9187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_06764genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.77.3e-20130176148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v ++G+  W++Ia+ ++ gR +kqc++rw+++l
    C.cajan_06764 130 KGPWTQEEDDKIVELVSKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 176
                      79******************************.*************97 PP

2Myb_DNA-binding51.32.7e-16182225146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ +  gRt++ +k++w++
    C.cajan_06764 182 KDAWTLEEELALMNAHRIHGNK-WAEIAKVLH-GRTDNAIKNHWNS 225
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.40154124IPR017877Myb-like domain
SMARTSM007176858126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-9105136IPR009057Homeodomain-like
PROSITE profilePS5129433.151125180IPR017930Myb domain
SuperFamilySSF466891.94E-31127223IPR009057Homeodomain-like
SMARTSM007171.9E-18129178IPR001005SANT/Myb domain
PfamPF002496.3E-19130176IPR001005SANT/Myb domain
CDDcd001673.36E-16132176No hitNo description
Gene3DG3DSA:1.10.10.607.2E-28137182IPR009057Homeodomain-like
SMARTSM007177.3E-15181229IPR001005SANT/Myb domain
PROSITE profilePS5129421.338181231IPR017930Myb domain
PfamPF002492.0E-14182225IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-22183231IPR009057Homeodomain-like
CDDcd001672.81E-11184227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MAEVKSEECC QENKQSTAAS CSSVSEGSGS AIHKSPGICS PASTSPSHRR TTGPIRRAKG  60
GWTAQEVGLY SFFFNFTCKL FGVSRRGGVA RGGGVAQRRW LRRGAEFFPD RSEVQCLHRW  120
QKVLNPELVK GPWTQEEDDK IVELVSKYGP TKWSLIAKSL PGRIGKQCRE RWHNHLNPDI  180
KKDAWTLEEE LALMNAHRIH GNKWAEIAKV LHGRTDNAIK NHWNSSLKKK LEFYLATGRL  240
PPIPKNSPQV AVKDTIRRSA SKTLLVCSNK ELNAVVETSS ETTAISKLDD SGRNQFESSG  300
TVREVGDCSS VPANESADSD CVECKPGPSN IDLGCSNSEQ VLIGTSSQES PTCGSLCYEP  360
PQLDGSVPID SLYLNYICQQ NEYRMSPTLS PIGFFTPPRV KGSELCTETP ESILKKAANT  420
FPNTPSILRR RRTGVQTLTS PSKVLKVDND PHTSNEIERT KYDSGSRHLS GSPASHHNGI  480
VNASPPYRLR SKRTAIVKSV EKQLEFAFDK DKNNDKRSNV ITEDCLHETK LVVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-6110523133159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-6110523133159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0531440.0BT053144.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-A-18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602590.10.0PREDICTED: myb-like protein A
TrEMBLA0A151U4N20.0A0A151U4N2_CAJCA; Myb-related protein 3R-1
STRINGGLYMA18G39740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.11e-135myb domain protein 3r-3